PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g38160.2.p
Common NameBRADI_2g38160, LOC100825285
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 1277aa    MW: 138931 Da    PI: 6.5417
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g38160.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.53.6e-09757799347
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +WT eE e + +  + +G++ +++I++ ++ ++t  +c+++++k+
  Bradi2g38160.2.p 757 PWTHEEKEVFMQMLATFGKN-FSKISNFLQ-HKTTADCVEFYYKH 799
                       8*****************99.*********.************97 PP

2Myb_DNA-binding22.33.1e-079681008345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding    3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45  
                         WT +E  ++v+a + +G++ +++I++++   ++ +qck ++ 
  Bradi2g38160.2.p  968 DWTDDERSIFVEAMNIYGKD-FARISSRVK-SKSYEQCKVFFS 1008
                        6*****************99.********9.********8776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.13E-15740802IPR009057Homeodomain-like
PROSITE profilePS5129315.053753804IPR017884SANT domain
SMARTSM007171.1E-8754802IPR001005SANT/Myb domain
PfamPF002497.0E-7756799IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-7756801IPR009057Homeodomain-like
PROSITE profilePS5129314.159641015IPR017884SANT domain
SMARTSM007172.2E-69651013IPR001005SANT/Myb domain
SuperFamilySSF466893.82E-99681010IPR009057Homeodomain-like
PfamPF002499.7E-69681008IPR001005SANT/Myb domain
CDDcd001671.18E-59691007No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1277 aa     Download sequence    Send to blast
MPPPPPDRRD FLYRDGRRHD GGGAGGDHLP LPAPTPPRWR DSPYHPPPPP PPLRDHARPS  60
PRRTTSSVSS ETYYRQGAAA YERSYPDEPL GYTPSRSDRY WLEEDAGGYK GFSRYGGGGG  120
RREGRDMRGS YRRSPFRSYG GDFPRGHQEP PPPPLRRSPL RSVAVPISYD PPGDKADRED  180
REHHPRVTPW RPLRRRETRS DAADAAGAGP TSVRQNTGEG TASEKKAPAQ SLAVAAPQTS  240
EEEAPRKKPR LGWGQGLAKY EKQKVHGSAD PAEAVADGSS ADVEQKVDVG TPASVLCASP  300
VAASPPAPPS SSPDTDNKSC ELTTNTATVS NKDVPGAEVQ AYNDEIPIKL GQLDGDPIGS  360
LANVLAELLQ HDDSCSGDSR KLTNTSKLLL LKENITKEIE KTELEIDSLE CELKSANTDI  420
GNRALEDAQN PSPSSGTSKV PVRPEICETS SPLKEQGEIS PCKISVEQDT DAKGAESMEV  480
DTAPAYNVTA VSSEESVARP VVAETQVSVA ASVAPVKPSR GTGSQIDADS ERQGPSSCHD  540
NVNSMKADGS NQLSTRPCSH HVDTHNLIPS ILAVNNGMAK EFNELVFKPL PSDQPLSALG  600
PFSIQMKNDL SIKRKLAIHK NRLRFKEQTL TFKFKVLRHL WKEDVRLLCV RKQRPKSNKR  660
TDQSNRASQS GSQRQRSSNR SRLGIPAGNL STFPTSEISE VANKMFTEFQ FKRCRNYLKM  720
PAVIIDEKEK ACAMFVSKNG LIEDPVSVEK ERAVINPWTH EEKEVFMQML ATFGKNFSKI  780
SNFLQHKTTA DCVEFYYKHH KSDSFREVKK LLDRRQQQQP TSNYLGTKSG KKWNPEGNAA  840
SLDMLGAASV VAAHGLDYAN RVEKTSSKSI IRTSYRSDIS AVAKGSLDKD CVANVSLHER  900
ESVAADVLAG ICGTLSPEGM GSCITSSADP GQKMGGARME YLVTPEVDKS CDEEGTFSDQ  960
ECEVYSVDWT DDERSIFVEA MNIYGKDFAR ISSRVKSKSY EQCKVFFSKA RISLGLDMIH  1020
PRNADAGLPT SDTNGGRSDT DEACAAEIDS AICSTQSSQK MEIDACPAAD ETTQGCHVSG  1080
ITFIQSKTDR STEPVVGDIK FEEAENKAED RSCNILVDHE LLSEATRQAS QSCDPIDINS  1140
SANTKNVQNK VHGNQVTVHG NVAMSSSTEQ PVGSQLEIRS NLHDTEVIQS SKASAGTCTQ  1200
ISSMEGPSNH APEIALMKVG NFTPSVVLSG DCGSKENVVH FQDMAGVSCI RPAFTSSYQQ  1260
SVPADLLQSK PKPQPP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4a69_D4e-15715806494NUCLEAR RECEPTOR COREPRESSOR 2
4a69_C4e-15715806494NUCLEAR RECEPTOR COREPRESSOR 2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231802.10.0PREDICTED: uncharacterized protein LOC100825285
TrEMBLA0A0Q3KAE00.0A0A0Q3KAE0_BRADI; Uncharacterized protein
STRINGBRADI2G38160.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52250.18e-77MYB family protein